KEGG   Trachymyrmex septentrionalis: 108755254
Entry
108755254         CDS       T11226                                 
Name
(RefSeq) green-sensitive opsin-like
  KO
K04256  c-opsin
Organism
tsep  Trachymyrmex septentrionalis
Brite
KEGG Orthology (KO) [BR:tsep00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tsep01009]
    108755254
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:tsep04030]
    108755254
Protein phosphatases and associated proteins [BR:tsep01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108755254
G protein-coupled receptors [BR:tsep04030]
 Rhodopsin family
  Vision
   Opsin
    108755254
SSDB
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 108755254
NCBI-ProteinID: XP_018353657
UniProt: A0A195ET22
LinkDB
Position
Unknown
AA seq 312 aa
MSLNLSVEEQPPAGIYIFAAIALGFIGFFGFFLNLLVIITIVKNANVLWTPNNVVLINMV
IGDFLVAALGNPFTITSAIAGEWFWSHEVCLWYAWFMTTMGFASIGNLTVMAMERFLLVT
CPMKTLSIRHAYILAILVWMYALSLSLPPFFNWGIYGPEAGNISCSVSWEIHDPDTHNDT
YIGFLFIVGFFLPVMIIVSSYCGIIKTLRKIGKRVGARNRREKKVTKMVYLMIFAFLIAW
LPYAVLALATQYFYVQASYILAVLPALLAKSSICYNPIIYASMTAQFPTWKKMFSINNAK
SKQQHGSELQTK
NT seq 939 nt   +upstreamnt  +downstreamnt
atgtcgttgaatctgagtgtcgaggaacaaccaccagctggtatctatattttcgcagcg
attgccctaggttttatcggtttttttggttttttcttgaatcttctggtcataataacg
attgtcaaaaacgccaatgtactgtggacacccaacaacgtggtcctcatcaacatggtt
attggagatttcttagttgctgcactgggaaacccattcacaataacatcggccattgca
ggtgaatggttttggagtcacgaagtgtgtctatggtacgcgtggtttatgactacaatg
ggatttgccagtatcggtaatctgacagtgatggcaatggagagattcctattagttaca
tgcccgatgaagacactatcaataaggcatgcttacatattggcgattttggtttggatg
tatgcgctctctttatcattaccgccgtttttcaattggggaatttatggtccggaagca
ggtaacatatcctgcagcgtatcttgggagatacacgatcctgatacgcacaacgacact
tacattggatttttatttattgttggattcttccttcctgttatgataattgtcagcagc
tattgcggcataataaaaactttaaggaaaataggaaaaagagtaggtgcgagaaataga
cgggaaaagaaagtcactaagatggtatacttaatgatttttgcttttctaattgcttgg
ttgccatacgctgttcttgcacttgcaactcaatatttttacgtacaagcttcctatatc
ttagcggtgctgccagcgctcctcgcgaaatcctctatttgctacaatccaattatatac
gcgagtatgacagcccagttccccacttggaaaaaaatgttttccatcaataacgctaaa
agtaagcaacagcatggaagtgaacttcaaacaaaatag

DBGET integrated database retrieval system