Thermococcus sibiricus: TSIB_0030 Help Entry TSIB_0030         CDS       T00928                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism tsi  Thermococcus sibiricus Pathway tsi03010   Ribosome Brite KEGG Orthology (KO) [BR:tsi00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     TSIB_0030   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     TSIB_0030  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tsi03011]     TSIB_0030    04121 Ubiquitin system [BR:tsi04121]     TSIB_0030   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tsi04147]     TSIB_0030 Ribosome [BR:tsi03011]  Ribosomal proteins   Eukaryotes    Small subunit     TSIB_0030   Archaea     TSIB_0030 Ubiquitin system [BR:tsi04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    TSIB_0030 Exosome [BR:tsi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    TSIB_0030   Exosomal proteins of colorectal cancer cells    TSIB_0030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Cas12f1-like_TNB Ribosomal_L37e Zn_ribbon_NUD Zn_ribbon_Nudix IBR Zn_ribbon_IS1595 Rcat_RNF216 Zn_Ribbon_1 Zn_ribbon_RPB9 zf-FPG_IleRS GFA Zn_ribbon_3 Zn_Ribbon_TF PknG_rubred Motif Other DBs NCBI-ProteinID:  ACS89101 UniProt:  C6A0F6 LinkDB All DBs Position 27000..27167 Genome browser AA seq 55 aa AA seqDB search MAGKKTSQKWKLYEVKDGKISRKNRFCPRCGPGVFMADHKNRWTCGRCGYTEWKK NT seq 168 nt NT seq  +upstreamnt  +downstreamnt atggccggaaagaaaacatcacaaaagtggaagctctatgaagttaaggatggcaaaatc tcaaggaagaacaggttctgcccaaggtgtggtcctggagtattcatggcagaccacaag aacagatggacatgcggtagatgcggttacaccgagtggaagaagtag

DBGET integrated database retrieval system