Tenacibaculum singaporense: D6T69_07840 Help Entry D6T69_07840       CDS       T09846                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism tsig  Tenacibaculum singaporense Brite KEGG Orthology (KO) [BR:tsig00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tsig03032]     D6T69_07840    03036 Chromosome and associated proteins [BR:tsig03036]     D6T69_07840    03400 DNA repair and recombination proteins [BR:tsig03400]     D6T69_07840 DNA replication proteins [BR:tsig03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     D6T69_07840 Chromosome and associated proteins [BR:tsig03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     D6T69_07840 DNA repair and recombination proteins [BR:tsig03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       D6T69_07840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-DNA_bdg Motif Other DBs NCBI-ProteinID:  AZJ35438 UniProt:  A0A3S8R6Q5 LinkDB All DBs Position complement(1770055..1770327) Genome browser AA seq 90 aa AA seqDB search MNKSDLIDAMAADAGISKAAAKAALDSLTDNVTKTLKKGDKVALVGWGTWSVSKRAARTG RNPQTGKEIKIAAKNVVKFKAGAGLSNSVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaatcagatttaatcgatgcgatggctgctgatgcaggaatttcaaaagctgct gctaaagctgcattagactctttaactgataacgtaacaaaaactttaaagaaaggtgat aaagttgctttagttggatggggaacttggtctgtttctaagagagctgctagaactggt agaaaccctcaaacaggaaaagaaattaagattgctgctaaaaatgtagttaagtttaaa gctggtgctggtttaagcaattcagtaaactaa

DBGET integrated database retrieval system