Thermocoleostomius sinensis: OXH18_12175 Help Entry OXH18_12175       CDS       T09238                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism tsin  Thermocoleostomius sinensis Brite KEGG Orthology (KO) [BR:tsin00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tsin03032]     OXH18_12175    03036 Chromosome and associated proteins [BR:tsin03036]     OXH18_12175    03400 DNA repair and recombination proteins [BR:tsin03400]     OXH18_12175 DNA replication proteins [BR:tsin03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     OXH18_12175 Chromosome and associated proteins [BR:tsin03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     OXH18_12175 DNA repair and recombination proteins [BR:tsin03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       OXH18_12175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 DUF2267 RepL HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  WAL62711 UniProt:  A0A9E8ZPQ6 LinkDB All DBs Position 2824873..2825151 Genome browser AA seq 92 aa AA seqDB search MNKGELVDKVAEKANVTKKQADAVLTAAIDSIMEAVSQGDKVTLVGFGSFEPRERKAREG RNPKTGEAMEIPATKVPAFSAGKLFKEMVAPK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaggtgaattggtggataaagttgcagagaaggcaaacgtcaccaagaagcaa gccgatgccgtgttaacggctgcgatcgattccatcatggaagccgtttcccagggtgac aaagtaacattggttggctttgggtcatttgagccacgagagcgcaaggctcgcgaaggt cgcaatcccaaaactggagaagcaatggaaattccggcaactaaagttcctgctttttct gccggtaaactttttaaagagatggttgctcccaagtaa

DBGET integrated database retrieval system