Thermocoleostomius sinensis: OXH18_23700 Help Entry OXH18_23700       CDS       T09238                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism tsin  Thermocoleostomius sinensis Pathway tsin00190   Oxidative phosphorylation tsin00195   Photosynthesis tsin01100   Metabolic pathways Module tsin_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:tsin00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     OXH18_23700 (atpE)    00195 Photosynthesis     OXH18_23700 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:tsin00194]     OXH18_23700 (atpE) Photosynthesis proteins [BR:tsin00194]  Photosystem and electron transport system   F-type ATPase [OT]    OXH18_23700 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  WAL60136 UniProt:  A0A9E9C4J9 LinkDB All DBs Position 5464792..5465037 Genome browser AA seq 81 aa AA seqDB search MNPTIAAASVLAAALAVGLGAIGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALVLLFANPFA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaatccaacaattgctgccgcttctgttcttgctgctgctctcgctgtcggactgggc gcgatcggtcctggtatcggccaagggaatgcggcaggtcaagctgtggaagggattgcc cgccagcctgaagcagaaggtaaaattcgcggtaccttgctcctgagcttggcgtttatg gaagcgctgacgatttatggtctggtggtggcattagtgctcctattcgctaaccccttc gcttag

DBGET integrated database retrieval system