Terrihabitans soli: IZ6_14730 Help Entry IZ6_14730         CDS       T07468                                  Name (GenBank) transcriptional regulator   KO K03530   DNA-binding protein HU-beta Organism tso  Terrihabitans soli Brite KEGG Orthology (KO) [BR:tso00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tso03032]     IZ6_14730    03036 Chromosome and associated proteins [BR:tso03036]     IZ6_14730    03400 DNA repair and recombination proteins [BR:tso03400]     IZ6_14730 DNA replication proteins [BR:tso03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     IZ6_14730 Chromosome and associated proteins [BR:tso03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     IZ6_14730 DNA repair and recombination proteins [BR:tso03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       IZ6_14730 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 HU-CCDC81_euk_1 DUF2267 Motif Other DBs NCBI-ProteinID:  BCJ90738 UniProt:  A0A6S6QW49 LinkDB All DBs Position 1411585..1411860 Genome browser AA seq 91 aa AA seqDB search MNKSDLIAAVADKAGLSRSQASAAVEATIDSIVDQLKQGADVRLVGFGTFQVVKRAAGVG RNLRTGQAIKIPASKTPKFRAGQVLKDAINR NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaacaagtccgatctgatcgcggctgtcgcggataaagcggggctcagccggtctcag gcttcggcggctgtcgaagcgacgatcgattccattgtcgatcaattgaaacagggcgcc gatgtgcgccttgtcggttttggtacattccaggtggtgaagcgggcggcgggcgtcggc cgcaatctgcgaaccggacaggcgatcaagattccggcgtcgaagacgccgaagtttcgc gccggccaggtgctgaaggatgcgattaaccgctga

DBGET integrated database retrieval system