Terrihabitans soli: IZ6_15820 Help Entry IZ6_15820         CDS       T07468                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tso  Terrihabitans soli Pathway tso01100   Metabolic pathways tso01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tso00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IZ6_15820 (acpP)    00074 Mycolic acid biosynthesis     IZ6_15820 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IZ6_15820 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  BCJ90847 UniProt:  A0A6S6QSD2 LinkDB All DBs Position 1521254..1521490 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIEHLGVDADKVTEKASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDATKFLEKNAA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgacattgccgaacgggttaagaagatcgtgatcgagcatctgggcgtggatgcg gacaaggtcacggaaaaggccagcttcatcgacgatctgggcgctgacagcctcgacacg gttgagctcgtgatggctttcgaggaagaattcggcgtcgagatcccggacgatgcggcc gagacgatccttacggtgggcgacgccacgaagttcctcgagaagaacgccgcctga

DBGET integrated database retrieval system