Trichinella spiralis: Tsp_03972 Help Entry Tsp_03972         CDS       T01609                                  Name (RefSeq) Cdc42-like protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism tsp  Trichinella spiralis Pathway tsp04145   Phagosome tsp04148   Efferocytosis tsp04310   Wnt signaling pathway tsp04361   Axon regeneration tsp04620   Toll-like receptor signaling pathway tsp05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:tsp00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     Tsp_03972  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     Tsp_03972    04148 Efferocytosis     Tsp_03972  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     Tsp_03972   09158 Development and regeneration    04361 Axon regeneration     Tsp_03972  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     Tsp_03972  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tsp04131]     Tsp_03972   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tsp04147]     Tsp_03972    04031 GTP-binding proteins [BR:tsp04031]     Tsp_03972 Membrane trafficking [BR:tsp04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     Tsp_03972  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     Tsp_03972   Macropinocytosis    Ras GTPases     Tsp_03972  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     Tsp_03972 Exosome [BR:tsp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Tsp_03972   Exosomal proteins of other body fluids (saliva and urine)    Tsp_03972   Exosomal proteins of colorectal cancer cells    Tsp_03972   Exosomal proteins of bladder cancer cells    Tsp_03972 GTP-binding proteins [BR:tsp04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     Tsp_03972 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  10904226 NCBI-ProteinID:  XP_003374783 LinkDB All DBs Position Unknown AA seq 205 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVSHHCPNTPIILVGTKLDLR EEQDTIEKLRERRLQPIVHQQGLAMAKEIGSVKYVECSALTQKGVKNVFDEAIRAVLYPV CRKHFERNCKKCENRSVRRRMCSIL NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgatcaagtgcgttgttgttggcgatggagccgtcggtaaaacttgtcttttg ataagttacactacgaatgcgtttcccggcgaatacattccaacagtttttgacaattat tctgccaacgttatggtggatgggaagccaattaacttaggattatgggatacagcgggt caggaggactatgatagacttagaccgttgtcgtatccgcagacggatgtatttttgata tgtttttcgttggtaaatccagcatcttttgaaaatgtgagagcaaagtggtttcctgaa gtaagtcaccattgtccaaacacgccaataattcttgtcggcacgaaacttgaccttcgt gaggagcaggacacgatagaaaagcttcgagaacggcgcttgcagccgattgtacatcag caaggtttggcgatggccaaagagataggttcggtaaaatatgtcgaatgctctgcgttg actcaaaaaggagtgaagaatgtttttgatgaggcaattcgtgcggtgctctaccctgtg tgtcgaaaacacttcgaacgaaactgcaagaaatgtgaaaatcgttccgttcgtcgtcga atgtgcagtattttatga

DBGET integrated database retrieval system