Trichinella spiralis: Tsp_06400 Help Entry Tsp_06400         CDS       T01609                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism tsp  Trichinella spiralis Pathway tsp03020   RNA polymerase tsp03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tsp00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     Tsp_06400   09124 Replication and repair    03420 Nucleotide excision repair     Tsp_06400  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:tsp03021]     Tsp_06400    03400 DNA repair and recombination proteins [BR:tsp03400]     Tsp_06400 Transcription machinery [BR:tsp03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      Tsp_06400   RNA polymerase III system    RNA polymerase III      Tsp_06400   RNA polymerase I system    RNA polymerase I      Tsp_06400 DNA repair and recombination proteins [BR:tsp03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       Tsp_06400 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Zn_ribbon_RPAB4 Zn_ribbon_13 MCM_OB DUF5816 Motif Other DBs NCBI-GeneID:  10909187 NCBI-ProteinID:  XP_003378536 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MSNPQTSTNPTTTPATTQTRGMIYVCGDCQFPNEIRARDPIRCRECGYRILYKKRTRQGI FSNVASVIMDISTGALMFLNVYISRSRYNECYLSDSESGVQ NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgagcaatcctcaaacgtccactaatccgactactacaccggctaccacacaaacgaga ggcatgatatacgtgtgtggagattgtcagttccctaatgaaattcgtgcaagagatccg attcgatgtcgtgaatgcggatatcgtattttatacaaaaaaagaactcgacaaggaata ttttcgaatgttgcatcagtgataatggatattagtactggtgcattgatgtttctcaat gtatatatatctagatctcgatataatgagtgttatctttcggacagtgaaagtggtgtg cagtag

DBGET integrated database retrieval system