Trichinella spiralis: Tsp_08385 Help Entry Tsp_08385         CDS       T01609                                  Name (RefSeq) GTP-binding protein YPT7   KO K07897   Ras-related protein Rab-7A Organism tsp  Trichinella spiralis Pathway tsp04137   Mitophagy - animal tsp04140   Autophagy - animal tsp04144   Endocytosis tsp04145   Phagosome tsp04148   Efferocytosis Brite KEGG Orthology (KO) [BR:tsp00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     Tsp_08385    04145 Phagosome     Tsp_08385    04140 Autophagy - animal     Tsp_08385    04137 Mitophagy - animal     Tsp_08385    04148 Efferocytosis     Tsp_08385  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tsp04131]     Tsp_08385   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tsp04147]     Tsp_08385    04031 GTP-binding proteins [BR:tsp04031]     Tsp_08385 Membrane trafficking [BR:tsp04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     Tsp_08385 Exosome [BR:tsp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Tsp_08385   Exosomal proteins of other body fluids (saliva and urine)    Tsp_08385   Exosomal proteins of colorectal cancer cells    Tsp_08385   Exosomal proteins of bladder cancer cells    Tsp_08385 GTP-binding proteins [BR:tsp04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     Tsp_08385 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase nSTAND3 cobW AAA_24 AAA_7 AAA_16 AAA_22 Septin ATPase_2 NB-ARC PduV-EutP NACHT AAA_5 TniB NTPase_1 DAP3 ATP-synt_ab SRPRB MCM ABC_tran Motif Other DBs NCBI-GeneID:  10904114 NCBI-ProteinID:  XP_003375392 LinkDB All DBs Position Unknown AA seq 146 aa AA seqDB search MATRKKVLLKVIILGDSGVGKTSLMNQYVNKRFSNQYKATIGADFLTKDVVVDDRFVTMQ IWDTAGQERFQSLGVAFYRGADCCVLILNIFLSLCLETKLIWKITPLVLNEHSSGVHRKT TFRILRFLLRKLSMSIWHFKKLHEMH NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atggcaactcgtaagaaagttttattgaaagtgatcattctcggcgacagtggggttgga aaaacatcgctcatgaatcaatatgtgaacaaaagattcagcaatcagtataaagctact attggagcagacttcttaaccaaggatgtggtcgtcgatgatcgtttcgtcacaatgcaa atttgggatacggccggccaagaacgttttcagtcgcttggtgtagcgttttaccgtggc gctgattgctgcgtacttatcctgaacattttcctttcattgtgcttggaaacaaaattg atatggaaaatcacaccgttagtactaaacgagcacagttctggtgttcatcgaaaaacg acattccgtattttgaggtttctgctaaggaagctatcaatgtcgatatggcatttcaaa aaattgcacgagatgcattag

DBGET integrated database retrieval system