Trichinella spiralis: Tsp_12500 Help Entry Tsp_12500         CDS       T01609                                  Name (RefSeq) putative LSM domain protein   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism tsp  Trichinella spiralis Pathway tsp03018   RNA degradation tsp03040   Spliceosome Brite KEGG Orthology (KO) [BR:tsp00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     Tsp_12500   09123 Folding, sorting and degradation    03018 RNA degradation     Tsp_12500  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tsp03019]     Tsp_12500    03041 Spliceosome [BR:tsp03041]     Tsp_12500 Messenger RNA biogenesis [BR:tsp03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      Tsp_12500   mRNA degradation factors    5'-3' decay     Lsm complex      Tsp_12500 Spliceosome [BR:tsp03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     Tsp_12500 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  10906356 NCBI-ProteinID:  XP_003367972 UniProt:  A0ABR3KHV5 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search MATPSTAVNPSTLLPLELIDKCIGSKLWIVMKGNKELVGTLLGFDDYVNIVLEDVIEYET TTEGKRITRLDQILLNGTHIAMLIPGGEGPEV NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggccacaccttcgaccgcagtgaatccatccactcttctgccgttggaattgatcgac aaatgcatcggatcgaaattgtggatcgtgatgaaagggaacaaagagttggtcggcacg ttgcttggattcgacgactacgtgaacattgtcctggaagatgtgatcgaatacgagacc actaccgaagggaaacgtatcaccagactcgatcagattctactcaacggcactcacatc gccatgctaattcctggtggtgaaggacctgaagtttga

DBGET integrated database retrieval system