Trichinella spiralis: Tsp_14098 Help Entry Tsp_14098         CDS       T01609                                  Name (RefSeq) histone H2B   KO K11252   histone H2B Organism tsp  Trichinella spiralis Brite KEGG Orthology (KO) [BR:tsp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tsp03036]     Tsp_14098   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tsp04147]     Tsp_14098 Chromosome and associated proteins [BR:tsp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     Tsp_14098 Exosome [BR:tsp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Tsp_14098 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF DUF1931 TFIID_20kDa LonB_AAA-LID YscO-like Motif Other DBs NCBI-GeneID:  10910656 NCBI-ProteinID:  XP_003366676 LinkDB All DBs Position Unknown AA seq 82 aa AA seqDB search VLKQVHADTGISSRAMSIMNSFVNDIFDRLAAEASRLAQYNQRHTITSREIQTAVRLLLP GELCKHAVSEGTKAVSKYNSGR NT seq 249 nt NT seq  +upstreamnt  +downstreamnt gtcttgaagcaagttcatgctgatactggcatcagcagcagggcgatgtcaatcatgaac agttttgtgaatgacatttttgatcgccttgccgctgaggcgagtcgtcttgcccaatac aatcaacgccacacgatcacttcacgggaaattcaaacggctgtccgtttacttttgcct ggtgaactttgcaaacatgcggtcagcgaagggaccaaagctgttagcaagtacaacagt ggaaggtaa

DBGET integrated database retrieval system