Trichinella spiralis: Tsp_14952 Help Entry Tsp_14952         CDS       T01609                                  Name (RefSeq) dynein light chain, cytoplasmic   KO K10418   dynein light chain LC8-type Organism tsp  Trichinella spiralis Pathway tsp04145   Phagocytosis tsp04517   IgSF CAM signaling tsp04814   Motor proteins Brite KEGG Orthology (KO) [BR:tsp00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     Tsp_14952  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     Tsp_14952   09142 Cell motility    04814 Motor proteins     Tsp_14952  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:tsp03037]     Tsp_14952    04812 Cytoskeleton proteins [BR:tsp04812]     Tsp_14952 Cilium and associated proteins [BR:tsp03037]  Motile cilia and associated proteins   Dynein arm    Tsp_14952 Cytoskeleton proteins [BR:tsp04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      Tsp_14952 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Ground-like FAM193A_N Motif Other DBs NCBI-GeneID:  10910310 NCBI-ProteinID:  XP_003366778 UniProt:  A0ABR3K3W7 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MENECEKNFTTLEEALQKEFKKVVQLCFLDMDMSMLRDVIKITFSTLEKYNDERDIAKAI KLTLDEKYMPPWHCIVGRKFSSKVTFQDSHCVHFVAGNKGFLLFRGKY NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggaaaatgaatgtgaaaaaaatttcacaacattggaagaagccctgcaaaaggaattc aagaaagttgttcagctgtgttttcttgatatggacatgagcatgctgcgtgatgtcata aaaataacgtttagcacgttggaaaaatataatgatgaaagagatattgcaaaagcaata aaattaacattagatgagaagtatatgccaccgtggcattgcattgttggtcggaaattt tcttcgaaagttacatttcaagacagtcattgtgtacacttcgtcgctggaaacaagggc tttctgctttttcgtggaaaatactaa

DBGET integrated database retrieval system