Trichinella spiralis: Tsp_15231 Help Entry Tsp_15231         CDS       T01609                                  Name (RefSeq) histone H3, embryonic   KO K11253   histone H3 Organism tsp  Trichinella spiralis Brite KEGG Orthology (KO) [BR:tsp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tsp03036]     Tsp_15231   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tsp04147]     Tsp_15231 Chromosome and associated proteins [BR:tsp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     Tsp_15231 Exosome [BR:tsp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Tsp_15231 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF TFIID-31kDa THSD1_D2 PRAI Motif Other DBs NCBI-GeneID:  10906245 NCBI-ProteinID:  XP_003368083 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search LLIRKLPFQRLVREVAQDYKTELRFQSSAVFALQEAAEAYLVGLFEDTNLCAIHAKRVTI MPKDVQLARRIRGMTNTNQKHRQSDTIKAIIHSHATNNTITLLSHVHA NT seq 329 nt NT seq  +upstreamnt  +downstreamnt aactgttgatcagaaagctgccattccagcgtttggttcgggaagttgctcaagattaca aaactgagttgcgattccaatcgtcagcagttttcgctttacaagaagcggctgaagctt acctggttggcctgttcgaagacacaaacttgtgtgctattcacgcaaaacgtgtcacca ttatgccaaaggatgttcagttggctcgtcgtatacggggcatgaccaatacaaatcaaa agcacagacagtcagacacaatcaaagcaatcattcattcacacgccaccaacaacacga tcacattgctcagtcatgttcacgcgtaa

DBGET integrated database retrieval system