Trichinella spiralis: Tsp_15232 Help Entry Tsp_15232         CDS       T01609                                  Name (RefSeq) hypothetical protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism tsp  Trichinella spiralis Pathway tsp03010   Ribosome tsp04120   Ubiquitin mediated proteolysis tsp04137   Mitophagy - animal tsp04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:tsp00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Tsp_15232   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Tsp_15232  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     Tsp_15232    04137 Mitophagy - animal     Tsp_15232  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tsp03011]     Tsp_15232    04121 Ubiquitin system [BR:tsp04121]     Tsp_15232 Ribosome [BR:tsp03011]  Ribosomal proteins   Eukaryotes    Large subunit     Tsp_15232   Archaea     Tsp_15232 Ubiquitin system [BR:tsp04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Tsp_15232 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD OTU1_UBXL UN_NPL4 Motif Other DBs NCBI-GeneID:  10906275 NCBI-ProteinID:  XP_003368053 LinkDB All DBs Position Unknown AA seq 70 aa AA seqDB search MLIFVKTLTGKTITLEVEPSDTIENVKSKIQDKEGIPPDQQRLVFAGNKEITILVNVQCQ SYFNRRYSAF NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgcttatattcgtgaagacacttactggaaaaactataacactagaagttgaaccatca gacaccatcgagaatgttaaaagtaaaattcaggataaggaaggcattcctcctgatcag caaagattagtctttgcaggtaataaagaaataacaattttagtaaatgtacaatgccaa tcttatttcaataggcggtactcagctttctaa

DBGET integrated database retrieval system