Trichinella spiralis: Tsp_15567 Help Entry Tsp_15567         CDS       T01609                                  Name (RefSeq) histone H2B, gonadal   KO K11252   histone H2B Organism tsp  Trichinella spiralis Brite KEGG Orthology (KO) [BR:tsp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tsp03036]     Tsp_15567   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tsp04147]     Tsp_15567 Chromosome and associated proteins [BR:tsp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     Tsp_15567 Exosome [BR:tsp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Tsp_15567 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  10897168 NCBI-ProteinID:  XP_003370311 LinkDB All DBs Position Unknown AA seq 69 aa AA seqDB search MTPKGVKKAGQLQKVAKSGDRRRRRLRKESFAGYIYKVLKQVHADTGISSRAMSIMNSFV NDIFDRPCR NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgactccgaaaggtgtaaagaaagcaggtcaactccagaaagtggccaagtctggcgat cgcagacgacgtcgtttgaggaaagaatcgttcgctggttacatctacaaggtcttgaag caagttcatgctgatactggcatcagcagcagggcgatgtcaatcatgaacagttttgtg aatgacatttttgatcgcccttgccgctga

DBGET integrated database retrieval system