Trichinella spiralis: Tsp_15676 Help Entry Tsp_15676         CDS       T01609                                  Name (RefSeq) histone H2B, gonadal   KO K11252   histone H2B Organism tsp  Trichinella spiralis Brite KEGG Orthology (KO) [BR:tsp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tsp03036]     Tsp_15676   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tsp04147]     Tsp_15676 Chromosome and associated proteins [BR:tsp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     Tsp_15676 Exosome [BR:tsp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Tsp_15676 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF LonB_AAA-LID DUF1931 DUF7794 YscO-like DUF7217 Motif Other DBs NCBI-GeneID:  10909938 NCBI-ProteinID:  XP_003368757 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MTPKGVKKAGQLQKVAKSGDRRRRRLRKESFAGYIYKVLKQVHADTGISSRAMSIMNSFV NDIFDRLAAEANHLAQYNQRHTITSREIQTAVRLLLPGELCKHAVSEGTKA NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgactccgaaaggtgtaaagaaagcaggtcaactccagaaagtggccaagtctggcgat cgcagacgacgtcgtttgaggaaagaatcgttcgctggttacatctacaaggtcttgaag caagttcatgctgatactggcatcagcagcagggcgatgtcaatcatgaacagttttgtg aatgacatttttgatcgccttgccgctgaggcgaatcatcttgcccaatacaatcaacgc cacacgatcacttcacgggaaattcaaacggctgtccgtttacttttgcctggtgaactt tgcaaacatgcggtcagcgaagggaccaaagct

DBGET integrated database retrieval system