Trichinella spiralis: Tsp_16023 Help Entry Tsp_16023         CDS       T01609                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism tsp  Trichinella spiralis Pathway tsp03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:tsp00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     Tsp_16023  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tsp03036]     Tsp_16023   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tsp04147]     Tsp_16023 Chromosome and associated proteins [BR:tsp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     Tsp_16023 Exosome [BR:tsp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Tsp_16023 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Histone_H2A_C Cdc6_lid ParE_like Motif Other DBs NCBI-GeneID:  10905904 NCBI-ProteinID:  XP_003368420 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MSGRVKGGKVKGKAKTRSSRAGLQFPVGRIHRLLKKGNYAERIGAGGPVYLAAVMEYLTA EVLELAGNAARDNKKTRITPRHIQLAIRNDEELSEFLRGVTIAQ NT seq 313 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcgtgaaaggtggaaaagttaaaggaaaagcaaagactcgatctagtcga gctggactccagttccctgttggtcgcattcatcgtcttttgaaaaagggaaattacgct gagcgtattggtgctggaggtcctgtctatcttgctgctgtcatggaatacttgaccgct gaagtactcgaattggctggaaacgccgcccgtgataacaagaagactcgaatcactcca cggcatatacagttggcaatacgaaatgatgaagagttgagcgagttcctccggggtgta actattgctcaag

DBGET integrated database retrieval system