Telmatocola sphagniphila: KIH39_26260 Help Entry KIH39_26260       CDS       T07229                                  Symbol atpC Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism tsph  Telmatocola sphagniphila Pathway tsph00190   Oxidative phosphorylation tsph01100   Metabolic pathways Module tsph_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:tsph00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     KIH39_26260 (atpC)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:tsph00194]     KIH39_26260 (atpC) Photosynthesis proteins [BR:tsph00194]  Photosystem and electron transport system   F-type ATPase [OT]    KIH39_26260 (atpC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Polo_box_3 Motif Other DBs NCBI-ProteinID:  QVL32293 UniProt:  A0A8E6B5G8 LinkDB All DBs Position complement(6553672..6553929) Genome browser AA seq 85 aa AA seqDB search MKELHCEIVTPEKKVLEATAEFIVLPMENGELGVLFDHAPMIGKLGKGEVRLTHNGVVKK LIVDGGFAQIRSNVVNVLTPRVKMD NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaaagaactccactgcgaaatcgtgaccccagagaagaaggttctggaagccaccgcg gagtttatcgttctcccgatggaaaatggtgaactcggcgtactgttcgaccacgccccg atgattggcaaactcggcaaaggggaagttcgactgacccacaacggcgtcgtcaaaaag ctgattgtcgatggcggtttcgctcagatccgctcgaatgtggtcaacgtgctcacgcct cgcgtgaaaatggattga

DBGET integrated database retrieval system