KEGG   Trachemys scripta elegans (red-eared slider): 117869734
Entry
117869734         CDS       T07347                                 
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8-like
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
tst  Trachemys scripta elegans (red-eared slider)
Pathway
tst04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:tst00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    117869734
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:tst04050]
    117869734
   04090 CD molecules [BR:tst04090]
    117869734
Cytokine receptors [BR:tst04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   117869734
CD molecules [BR:tst04090]
 Proteins
  117869734
SSDB
Motif
Pfam: TNFR_c6 Prok-JAB
Other DBs
NCBI-GeneID: 117869734
NCBI-ProteinID: XP_034612696
LinkDB
Position
24:15063119..15104075
AA seq 516 aa
MAARGLLLLLLLQGTQAAPPQTLIISPQSCNVLENWLYDETSQRCCYQCPSGYHKRKECP
TDPDRDCGQCEPEHFLNREQGKPRCEACVSCKPEYDLVEKVPCSFNSRRVCECRAGLFCK
VAVLNSCARCISHTVCKPGFGVLVRGTSEVDVSCQECPLGTFSERHSSTERCKPHTDCAK
LNKVAVDSGNSTHDQVCMDPPPTHLTPATLSAKFSNESKDSDRAKAPLLNEQPTTVGGQH
SHTTTKPVTSASILTSDAASGDANWTAAGTVGGSDTKHAAGTSPTSDIATEKTAKTGDGS
FVPWGAVVLCSMVLLAGMLAVWQRKACKRRIFTPNGKTLDLYPVTTCRLKSSSQGSDLMK
NCAKRFSMLKADKESEERELLNRIPVVETNNNLVSSSEKNPSPDSSLAETIQSTGNATDY
PADSRVRDHTNNRIDKIYIMKADTVIVGSISEVPVSKNCAVRGCENDSKAQENMEENELA
MHYPQQETESFPGSDVMIPVEEEGKEFHHPTTATEK
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggctgcccgggggctgctgctcctgctgcttctccaggggacccaggcggcgcccccg
cagacattgattatctcacctcagtcctgtaatgtgctagagaactggctctatgatgaa
acttcacaacgctgctgctaccagtgtccctcaggctatcataaacggaaagagtgtccc
acagatccagaccgggactgtgggcagtgtgaacccgagcacttcctgaacagggagcaa
gggaagccacgctgcgaggcctgcgtgtcgtgcaagccagaatacgaccttgtggagaaa
gtcccttgctccttcaattccagaagggtgtgtgagtgccgagcagggctgttttgtaag
gttgccgttctgaacagctgtgcgcgatgcatttcccacactgtctgcaagccaggattt
ggagtcctagtcagaggcacctcagaagttgatgtctcctgccaagaatgccctttgggg
accttctctgagcggcactccagcaccgaacgctgcaagccccacacggactgtgccaag
ctaaacaaagtagccgtggacagcggaaattccacacacgaccaagtctgcatggaccca
cctcccacccacctcacacctgccactttgtctgcgaaattcagcaacgagtcgaaggat
tccgacagggcaaaagcgccgctcctgaacgagcagccaacaaccgtgggaggccagcat
tcccacactaccacaaagccagtgaccagcgccagcatcctcacgagtgatgcagcctct
ggtgatgccaactggactgctgcgggaaccgtcggtggatcggatacaaaacacgcagct
ggcacttctcctacctcagatatagctacagaaaagactgccaagacaggtgatgggagc
tttgttccctggggtgcggtggttctttgcagcatggtgcttctcgctggtatgctggcg
gtttggcaaaggaaggcttgcaagaggcggatcttcacccccaatgggaagactcttgat
ctgtatccagtcactacatgtagactcaaatcttcaagtcagggttctgatctgatgaag
aactgtgcaaagaggttcagtatgctgaaagctgacaaagagtcagaagagagggagttg
ttaaacagaatccccgttgtggaaaccaacaacaacttggtctccagctcagaaaaaaat
cccagtcctgactcaagcctggctgagacgatccagagcaccgggaatgccacagactac
cccgctgattcccgagtgagggaccacactaataaccgaatcgacaaaatatacataatg
aaagccgacactgtgattgtggggtccatttcggaagtgcccgtcagcaagaactgcgcg
gttagaggatgtgaaaatgattctaaggctcaagaaaacatggaggaaaatgaacttgca
atgcattatccgcagcaggagacagaatcgtttccaggaagtgatgtaatgattccagtg
gaggaggagggcaaggaatttcatcaccctaccactgccactgagaagtga

DBGET integrated database retrieval system