KEGG   Trachemys scripta elegans (red-eared slider): 117869973
Entry
117869973         CDS       T07347                                 
Symbol
SLC16A13
Name
(RefSeq) monocarboxylate transporter 13 isoform X1
  KO
K08189  MFS transporter, MCT family, solute carrier family 16 (monocarboxylic acid transporters), member 13
Organism
tst  Trachemys scripta elegans (red-eared slider)
Brite
KEGG Orthology (KO) [BR:tst00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tst02000]
    117869973 (SLC16A13)
Transporters [BR:tst02000]
 Solute carrier family (SLC)
  SLC16: Monocarboxylate transporter
   117869973 (SLC16A13)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Monocarboxylate transporter (MCT) family [TC:2.A.1.13]
    117869973 (SLC16A13)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 117869973
NCBI-ProteinID: XP_034612969
LinkDB
Position
25:6484647..6494300
AA seq 448 aa
MPVVHPEPPDGGWGWMVVLAAFFQSALVFGVIRSFGVFFMEFVGYFGELSGRVSWITSIG
IAVQQFASELCGGPVGSALSTQYGARPVVMAGGLLSGLGMLLASFATSLTHLYLSIGLLS
GFGWALVFTPSVASVARYFKKRRTFATGLAFTGVGLSSFAFSPLFQFLVDTYAWRGALLV
VAGMSFNLVVCGALIRPLTLKEDLASSGDPGGSCLGKLSTLFGLPLLSHWPFVRFVLAVT
LINTGYFIPYVHLVARARELGFDEYQAAFLMSVAAVADLCGRLLSGWLADCRAFRLSHIL
VAWTSLTGISLALVPLGRGYPLLMAISVCYGFFSGALTPVVFSILPEIVGIGRIFGSMGL
LQMMESIGGLLGAPFSGWLRDMTGDYMASFLAAGAFLLAGSLVLVTLPNFFSCLGTSSPA
CRGTQVEAGAEPAPLTPASGEHSSQDRD
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgccggtggtgcaccctgaaccccctgacgggggctggggctggatggtggtgctggcc
gccttcttccagtcggcgctggttttcggggtgatccgctccttcggggtcttcttcatg
gagtttgtggggtactttggggagctgtccgggcgggtgtcctggatcacctccatcggg
atcgcggtgcagcaatttgctagtgagttatgtggtggtccggtgggcagcgccctcagc
acccagtatggcgcccgccccgtggtgatggccgggggcctcctctcggggctgggcatg
ctcctggcttccttcgccaccagcctgacccacctgtacctgagcatcgggctgctctca
ggcttcgggtgggccttggtcttcacaccctccgtggcctcggtggctcgttacttcaag
aagcgccggacgttcgccacaggcttggccttcacgggcgtgggcctgtcctccttcgcc
ttctccccactcttccagttcctggtggacacctacgcctggcggggggccctcctggtg
gtggccggcatgtccttcaacctggtggtgtgtggagccctcatccgccccctgaccctc
aaggaggacctggccagctctggggaccctggcgggagctgcctgggaaagctttccacc
ctctttggcctgcctttgctctcccactggccctttgtgagatttgtgctagccgtgacc
ttgatcaacaccggctacttcattccctacgtccacttggtggcccgagcccgggagctg
ggcttcgatgagtaccaggctgccttcctcatgtccgtggcagccgtggccgacctgtgt
ggccgcctcctctcgggttggctggccgactgccgggctttccgcctcagccacatcttg
gtggcctggacctccctgactggcatctccttggcactggtgcctctggggcgcggctac
ccattgttgatggccatcagcgtctgttatgggttcttctccggggcgctcacccccgtg
gtcttttccatcctgccggaaattgtgggcattgggcggatttttggctctatggggctg
ctgcagatgatggagagcatcggcgggcttctgggagcgccgttctctggttggctgcgg
gacatgactggggactacatggcctctttcttggcagctggggctttcctcttggctggg
agcctggttttggtcactctgcccaacttcttctcctgcctgggcacctcctctcctgcc
tgccggggcacccaggtggaggcaggggcagagccggctccattgacaccagcctctggg
gaacattcctcccaggacagagactag

DBGET integrated database retrieval system