Thiomicrolovo sulfuroxydans: LOH54_02305 Help Entry LOH54_02305       CDS       T11233                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tsul  Thiomicrolovo sulfuroxydans Pathway tsul01100   Metabolic pathways tsul01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tsul00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LOH54_02305 (acpP)    00074 Mycolic acid biosynthesis     LOH54_02305 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LOH54_02305 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Ribosomal_L12_N PRD Motif Other DBs NCBI-ProteinID:  UFS62966 LinkDB All DBs Position 461397..461627 Genome browser AA seq 76 aa AA seqDB search MALLDDIKEVVVEQLSVNPDEVKPDAKFVEDLGADSLDVVELVMALEEKFDIEIPDDEAE KIQTVQDVVNYVENKA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcacttttggatgacatcaaagaagtcgtagttgaacaactgagcgtaaacccggac gaagtaaagccggatgcgaaattcgttgaagatctcggagcggacagcctcgacgtcgtt gaactggtcatggcacttgaagaaaaattcgatattgaaatcccggacgatgaagctgaa aaaattcagacagttcaggatgtcgtaaactacgtcgaaaacaaggcgtaa

DBGET integrated database retrieval system