Terricaulis silvestris: DSM104635_00986
Help
Entry
DSM104635_00986 CDS
T06781
Symbol
kdpD
Name
(GenBank) Sensor protein KdpD
KO
K07646
two-component system, OmpR family, sensor histidine kinase KdpD [EC:
2.7.13.3
]
Organism
tsv
Terricaulis silvestris
Pathway
tsv02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
tsv00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
DSM104635_00986 (kdpD)
09180 Brite Hierarchies
09181 Protein families: metabolism
01001 Protein kinases [BR:
tsv01001
]
DSM104635_00986 (kdpD)
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
tsv02022
]
DSM104635_00986 (kdpD)
Enzymes [BR:
tsv01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.13 Protein-histidine kinases
2.7.13.3 histidine kinase
DSM104635_00986 (kdpD)
Protein kinases [BR:
tsv01001
]
Histidine kinases
OmpR family
DSM104635_00986 (kdpD)
Two-component system [BR:
tsv02022
]
OmpR family
KdpD-KdpE (potassium transport)
DSM104635_00986 (kdpD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DUF4118
HATPase_c
HisKA
HATPase_c_2
Motif
Other DBs
NCBI-ProteinID:
QGZ94170
UniProt:
A0A6I6MH82
LinkDB
All DBs
Position
1026373..1027803
Genome browser
AA seq
476 aa
AA seq
DB search
MTCVLIALAALLARAAEAWLDPQSLALFFVVPIVVAAIRYGLWASLGAALLSALAINYLY
VEPRYTFVVARAQDAAALLLFSLVGALVSAIAARARAAALDAERRAREALLLQSLATRLA
ASGAEDEIADAVVDSLSALSGRAALLVDASDRHWGSGFGDAARAAARWSMSTKQPFTPSL
DAPSPSSWAFWPVVFAGRSEMALGVNAAEPLAPEIRRAAEQITAQAGVAMERARVARTAE
AARLEVERERLKTELLAGVSHDLRTPLSMIVFTLQSLQRFAADHPPETRDELLALAEAEA
RRLAEMVDTLLDASRIGVAAAPVRIETIAPRDLIARLRAEYAPSANIVDAQVAENLPLIS
ADLELAVRALANVVSNALRHGGAPVRIVASRRGGEVVIEISDTGPGLGDDPARLFERFVR
GAPDDGRAPGLGLGLTMARRFLEAQGARIVAANRPEGGAVFTITFAAAVKEVVYVG
NT seq
1431 nt
NT seq
+upstream
nt +downstream
nt
gtgacatgcgtgttgatcgcgcttgcagcgttgcttgcacgagccgccgaggcttggctc
gatccgcagagcctcgcgctcttttttgtggtgcctatcgttgtcgcggcgatccgctac
ggcctttgggcgtcgcttggagcggctctgctcagcgccctggcgatcaactatctctat
gtcgaaccgcgctacacattcgtagttgcccgtgcgcaggatgccgcagcgcttttgttg
ttttcgctggtcggcgcgctggtcagcgccatcgccgctcgtgcgcgcgcggctgcgctc
gacgcagagcggcgcgcaagggaagcgctcttgctgcagagcctcgccacgcgtttggcc
gcgagcggtgcggaggacgaaatagccgacgccgtcgtcgatagtctgtccgccttaagc
gggcgggcggcgctgttggtggatgcgagcgatcgccattggggcagtggctttggcgat
gccgcccgggccgccgcgcgttggtcgatgagcaccaagcagcccttcacgccctccctc
gatgcgcccagcccttcttcatgggcgttttggcccgtggtgtttgctggccgcagcgaa
atggcccttggcgtcaacgccgccgaacctctggcgccggagattcgacgggccgccgag
cagatcaccgcccaagccggtgttgcgatggagcgcgcacgcgtggcccggaccgcggaa
gctgcgcgcctcgaagtcgaacgcgaacgattgaagaccgaacttctagccggcgtctca
cacgatctgcgcacgccgttgtcgatgattgttttcacgttgcagagcctgcagcgtttc
gccgccgatcacccgcctgagacccgcgacgaacttctcgccttggcagaggccgaggcg
cgccggctggcggaaatggtcgataccttgctcgacgcgtcgcgcattggcgttgctgcc
gcacccgtaaggatcgaaacaatcgcgcccagagatctgatcgcccgactgcgggcagag
tatgcgccctcggcgaatatcgttgacgcgcaggtggcggagaatctgcctctgatctca
gccgacctggaactcgcggtgcgcgcgctggcgaacgtcgtgtcaaacgcactgcgtcat
ggcggcgcgccggttcggatcgtggcctcacggcgcggcggagaagtggtgatcgagatc
agtgataccgggccaggccttggcgatgatccggcgcgactgttcgagcgtttcgtgcgc
ggcgcccctgatgatggccgcgcacccggcctcggtcttggcctcaccatggcgcgcaga
tttctcgaagcccaaggcgcccgcattgtcgccgccaaccggccggaaggtggcgcggtg
ttcaccatcacgttcgcggccgccgtcaaagaggtcgtttatgttggctga
DBGET
integrated database retrieval system