KEGG   Terricaulis silvestris: DSM104635_00986
Entry
DSM104635_00986   CDS       T06781                                 
Symbol
kdpD
Name
(GenBank) Sensor protein KdpD
  KO
K07646  two-component system, OmpR family, sensor histidine kinase KdpD [EC:2.7.13.3]
Organism
tsv  Terricaulis silvestris
Pathway
tsv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tsv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DSM104635_00986 (kdpD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tsv01001]
    DSM104635_00986 (kdpD)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:tsv02022]
    DSM104635_00986 (kdpD)
Enzymes [BR:tsv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     DSM104635_00986 (kdpD)
Protein kinases [BR:tsv01001]
 Histidine kinases
  OmpR family
   DSM104635_00986 (kdpD)
Two-component system [BR:tsv02022]
 OmpR family
  KdpD-KdpE (potassium transport)
   DSM104635_00986 (kdpD)
SSDB
Motif
Pfam: DUF4118 HATPase_c HisKA HATPase_c_2
Other DBs
NCBI-ProteinID: QGZ94170
UniProt: A0A6I6MH82
LinkDB
Position
1026373..1027803
AA seq 476 aa
MTCVLIALAALLARAAEAWLDPQSLALFFVVPIVVAAIRYGLWASLGAALLSALAINYLY
VEPRYTFVVARAQDAAALLLFSLVGALVSAIAARARAAALDAERRAREALLLQSLATRLA
ASGAEDEIADAVVDSLSALSGRAALLVDASDRHWGSGFGDAARAAARWSMSTKQPFTPSL
DAPSPSSWAFWPVVFAGRSEMALGVNAAEPLAPEIRRAAEQITAQAGVAMERARVARTAE
AARLEVERERLKTELLAGVSHDLRTPLSMIVFTLQSLQRFAADHPPETRDELLALAEAEA
RRLAEMVDTLLDASRIGVAAAPVRIETIAPRDLIARLRAEYAPSANIVDAQVAENLPLIS
ADLELAVRALANVVSNALRHGGAPVRIVASRRGGEVVIEISDTGPGLGDDPARLFERFVR
GAPDDGRAPGLGLGLTMARRFLEAQGARIVAANRPEGGAVFTITFAAAVKEVVYVG
NT seq 1431 nt   +upstreamnt  +downstreamnt
gtgacatgcgtgttgatcgcgcttgcagcgttgcttgcacgagccgccgaggcttggctc
gatccgcagagcctcgcgctcttttttgtggtgcctatcgttgtcgcggcgatccgctac
ggcctttgggcgtcgcttggagcggctctgctcagcgccctggcgatcaactatctctat
gtcgaaccgcgctacacattcgtagttgcccgtgcgcaggatgccgcagcgcttttgttg
ttttcgctggtcggcgcgctggtcagcgccatcgccgctcgtgcgcgcgcggctgcgctc
gacgcagagcggcgcgcaagggaagcgctcttgctgcagagcctcgccacgcgtttggcc
gcgagcggtgcggaggacgaaatagccgacgccgtcgtcgatagtctgtccgccttaagc
gggcgggcggcgctgttggtggatgcgagcgatcgccattggggcagtggctttggcgat
gccgcccgggccgccgcgcgttggtcgatgagcaccaagcagcccttcacgccctccctc
gatgcgcccagcccttcttcatgggcgttttggcccgtggtgtttgctggccgcagcgaa
atggcccttggcgtcaacgccgccgaacctctggcgccggagattcgacgggccgccgag
cagatcaccgcccaagccggtgttgcgatggagcgcgcacgcgtggcccggaccgcggaa
gctgcgcgcctcgaagtcgaacgcgaacgattgaagaccgaacttctagccggcgtctca
cacgatctgcgcacgccgttgtcgatgattgttttcacgttgcagagcctgcagcgtttc
gccgccgatcacccgcctgagacccgcgacgaacttctcgccttggcagaggccgaggcg
cgccggctggcggaaatggtcgataccttgctcgacgcgtcgcgcattggcgttgctgcc
gcacccgtaaggatcgaaacaatcgcgcccagagatctgatcgcccgactgcgggcagag
tatgcgccctcggcgaatatcgttgacgcgcaggtggcggagaatctgcctctgatctca
gccgacctggaactcgcggtgcgcgcgctggcgaacgtcgtgtcaaacgcactgcgtcat
ggcggcgcgccggttcggatcgtggcctcacggcgcggcggagaagtggtgatcgagatc
agtgataccgggccaggccttggcgatgatccggcgcgactgttcgagcgtttcgtgcgc
ggcgcccctgatgatggccgcgcacccggcctcggtcttggcctcaccatggcgcgcaga
tttctcgaagcccaaggcgcccgcattgtcgccgccaaccggccggaaggtggcgcggtg
ttcaccatcacgttcgcggccgccgtcaaagaggtcgtttatgttggctga

DBGET integrated database retrieval system