Terricaulis silvestris: DSM104635_01956 Help Entry DSM104635_01956   CDS       T06781                                  Symbol hup Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism tsv  Terricaulis silvestris Brite KEGG Orthology (KO) [BR:tsv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tsv03032]     DSM104635_01956 (hup)    03036 Chromosome and associated proteins [BR:tsv03036]     DSM104635_01956 (hup)    03400 DNA repair and recombination proteins [BR:tsv03400]     DSM104635_01956 (hup) DNA replication proteins [BR:tsv03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     DSM104635_01956 (hup) Chromosome and associated proteins [BR:tsv03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     DSM104635_01956 (hup) DNA repair and recombination proteins [BR:tsv03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       DSM104635_01956 (hup) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 HU-CCDC81_euk_2 DUF3168 DUF937 Motif Other DBs NCBI-ProteinID:  QGZ95114 UniProt:  A0A6I6MR17 LinkDB All DBs Position 1894800..1895072 Genome browser AA seq 90 aa AA seqDB search MNKAELVADVADRMGDSKQKSEEAVNAVFEAIVAALKKGDEVRLPAFGVFDVKDTAARTA RNPQTGAEVKVPAGKKARFKPGKALKETLN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaagcagaattggtcgccgacgttgcggatcgcatgggcgattccaaacagaag agcgaagaggccgtgaacgccgtgtttgaagccatcgtcgccgccctcaagaagggcgac gaagtgcgactgccggccttcggcgtgttcgacgtgaaggacaccgccgcccgcaccgca cgcaacccgcagacgggcgccgaggtcaaagtgccggccggcaagaaggcccgcttcaag ccgggcaaggcgctcaaagaaacgctgaactga

DBGET integrated database retrieval system