Terricaulis silvestris: DSM104635_02189
Help
Entry
DSM104635_02189 CDS
T06781
Symbol
limB_3
Name
(GenBank) Limonene 1,2-monooxygenase
Organism
tsv
Terricaulis silvestris
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Bac_luciferase
Motif
Other DBs
NCBI-ProteinID:
QGZ95340
UniProt:
A0A6I6MJJ6
LinkDB
All DBs
Position
complement(2116883..2117872)
Genome browser
AA seq
329 aa
AA seq
DB search
MIPFSVLDLAPIVEGGSVAQALANSRDLAQAAERLGYKRFWLAEHHAMPGVASAATALTI
MNAAQATKTIRVGAGGIMLPNHAPIIIAEQFGTLEALFPGRIDLGLGRAPGGDGLTARAL
RRTLIGGEDRFPQDVMELQALLGPSEPGQRLRAVPGEGASTPLWMLGSSTFGAQLAAALG
LPFAFASHFAPAQMMSAIEIYRATFRPSDQLQKPYVMLGFNIFAAPTDEEGRLLATSLMQ
AFASLRRGEPRRLQPPDPAFEATLNDMERAQLDQVLQCSAIGSPATVKASIAAFVTRTGA
DELILASHIYDHAARVRAYEIAAAVRAEM
NT seq
990 nt
NT seq
+upstream
nt +downstream
nt
atgatcccattctcggttctcgatctcgcgcccatcgttgaaggcgggagcgttgcgcag
gcgttggcgaatagccgcgatttggcgcaagccgcggagcggttggggtacaagcgcttt
tggctggcggagcatcacgccatgccgggtgtcgcgagtgcggcgacggcgctcaccatc
atgaacgcggcgcaggcgaccaagacgatccgcgtcggcgccggcgggatcatgttgccg
aaccacgcgccgatcatcattgctgaacaatttgggacgcttgaggcgctgtttccgggg
cgcattgatctggggctcgggcgcgcacctggtggcgatgggctgactgcgcgtgcgctg
cggcggacgttgattggcggcgaggaccggtttccgcaggacgtgatggaattgcaggcg
ttgctcgggccgagcgagcctgggcaacgattgcgcgcggtgccgggtgagggcgcaagt
acgccgctgtggatgcttgggtcttcgacgttcggcgcgcagctcgcggcggcgcttggg
ttgccgttcgcgttcgcgtcgcactttgcgcctgcgcagatgatgagcgcgatcgagatt
tatcgcgcgacattccggccgtccgaccaattgcagaagccgtacgtgatgctgggcttc
aacattttcgcggcgccgacggacgaggaaggtcgtttgctggcgacatcgttgatgcag
gcgttcgcaagcttgcggcggggtgagccgcgtcggttgcagccgccagaccctgcgttt
gaagcgacgttgaatgacatggagcgggcgcagctcgatcaggtgctgcaatgctcggcc
atcggttcgccggcgacggtgaaggccagcatcgcggcgttcgtgacccgtactggcgcc
gacgaactcatattagcgtcgcacatctacgaccacgctgcgcgggtgcgggcttacgag
attgccgcagcggttcgggctgaaatgtag
DBGET
integrated database retrieval system