Terricaulis silvestris: DSM104635_02319 Help Entry DSM104635_02319   CDS       T06781                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism tsv  Terricaulis silvestris Pathway tsv01100   Metabolic pathways tsv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tsv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DSM104635_02319 (acpP)    00074 Mycolic acid biosynthesis     DSM104635_02319 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DSM104635_02319 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QGZ95470 UniProt:  A0A6I6MJU7 LinkDB All DBs Position complement(2246046..2246282) Genome browser AA seq 78 aa AA seqDB search MSEVFERVKAIVIKHLEAPPEKVVEKASFIDDLGADSLDNVELVMAFEEEFGIEIPDDAA EHIQTVGDAVKFISEKQG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcggaagtttttgagcgcgtaaaggcgatcgtgatcaagcacctcgaagccccgccg gagaaggtggtcgagaaggcctcgttcatcgacgatctgggcgctgacagcttggacaac gtcgaactcgtcatggcgttcgaagaagagttcggcatcgagattccggacgacgcggct gagcacattcagaccgtcggcgacgctgtgaagttcatctcggagaaacagggctaa

DBGET integrated database retrieval system