Thiobacillus sedimenti: VA613_05510 Help Entry VA613_05510       CDS       T10461                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tsw  Thiobacillus sedimenti Pathway tsw01100   Metabolic pathways tsw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tsw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VA613_05510 (acpP)    00074 Mycolic acid biosynthesis     VA613_05510 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VA613_05510 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Ribosomal_L12_N Bac_DnaA_C CH Motif Other DBs NCBI-ProteinID:  WRS40327 LinkDB All DBs Position 1128855..1129088 Genome browser AA seq 77 aa AA seqDB search MDNVQRVIKVVAEQLGVNEADIKNESSFVGDLGADSLDTVELVMALEEEFGCEIPDEDAE KITTVQQAIDYVNSHSA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggataacgtacagcgtgtaatcaaagtcgtcgccgagcaattgggcgtgaatgaagcg gacatcaagaacgagtcctccttcgtcggcgacctgggcgctgactcgctcgacaccgtt gaactggtgatggcgctggaagaggaattcggctgcgagatccccgacgaggacgccgag aagatcaccaccgtccagcaggcgattgactacgtcaacagccactcggcctga

DBGET integrated database retrieval system