Candidatus Thiodictyon syntrophicum: THSYN_02995 Help Entry THSYN_02995       CDS       T05211                                  Name (GenBank) hypothetical protein   KO K02372   3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59] Organism tsy  Candidatus Thiodictyon syntrophicum Pathway tsy00061   Fatty acid biosynthesis tsy00780   Biotin metabolism tsy01100   Metabolic pathways tsy01212   Fatty acid metabolism tsy01240   Biosynthesis of cofactors Module tsy_M00083   Fatty acid biosynthesis, elongation tsy_M00572   Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP Brite KEGG Orthology (KO) [BR:tsy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     THSYN_02995   09108 Metabolism of cofactors and vitamins    00780 Biotin metabolism     THSYN_02995  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:tsy01004]     THSYN_02995 Enzymes [BR:tsy01000]  4. Lyases   4.2  Carbon-oxygen lyases    4.2.1  Hydro-lyases     4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase      THSYN_02995 Lipid biosynthesis proteins [BR:tsy01004]  Fatty acid synthase   Component type    THSYN_02995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FabA PKS_DH_N ApeI-like Motif Other DBs NCBI-ProteinID:  AUB80031 UniProt:  A0A2K8U4Q3 LinkDB All DBs Position complement(699632..699937) Genome browser AA seq 101 aa AA seqDB search MSGAGGFVIPGRHPALAGHFPNLPVVPGSLILEQVLAAWDGPFYALAFAKFHAPLSPNEP VQVRFEPPAGGAARADGLVAFRCLRANELICSGLIRVAPAQ NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgagcggcgccggcggcttcgtcatcccgggcaggcatccggccctcgccggccatttc cccaacctgccggtggtgccgggctcgctgatcctggagcaggtcctcgcggcctgggac ggtcccttctacgcgctcgcgttcgccaaattccacgcccccttgagcccgaatgagccg gtgcaggtccgcttcgagccccccgccgggggcgcggcgcgggcggatgggttggtggcc ttccgttgtctgcgtgcgaacgagttgatctgctccggtctgatccgcgtcgcaccggcg caatga

DBGET integrated database retrieval system