Candidatus Thiodictyon syntrophicum: THSYN_07905 Help Entry THSYN_07905       CDS       T05211                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism tsy  Candidatus Thiodictyon syntrophicum Pathway tsy03060   Protein export tsy03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:tsy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     THSYN_07905  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     THSYN_07905  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tsy02044]     THSYN_07905 Secretion system [BR:tsy02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    THSYN_07905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AUB84690 UniProt:  A0A2K8UGL3 LinkDB All DBs Position 1846415..1846696 Genome browser AA seq 93 aa AA seqDB search MGLGGLHVWHLLILLVVVLLVFGTKKLKNIGQDLGDAVKGFRSAMGSGEKGEEPKQIDES APRRVADPAPTAARSKVGATPAAGDPRSDWPNS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgggccttggtggtttgcatgtctggcacctgttgatcctgttggtggtcgtgctgctg gtgttcggcaccaagaagctgaagaacatcggccaggacttgggcgatgcggtcaagggc tttcgcagcgccatggggtccggtgagaagggcgaggagcccaagcagatcgatgagtcc gcgccgcggcgcgtggccgatccggcgccgacggccgcgcggtccaaggtcggggcgacg cccgcggccggggacccgcgctccgattggccgaactcctga

DBGET integrated database retrieval system