Candidatus Thiodictyon syntrophicum: THSYN_22965 Help Entry THSYN_22965       CDS       T05211                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism tsy  Candidatus Thiodictyon syntrophicum Pathway tsy01100   Metabolic pathways tsy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tsy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     THSYN_22965    00074 Mycolic acid biosynthesis     THSYN_22965   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     THSYN_22965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Motif Other DBs NCBI-ProteinID:  AUB83526 UniProt:  A0A2K8UD89 LinkDB All DBs Position complement(5459736..5459963) Genome browser AA seq 75 aa AA seqDB search MNRQEFLTAMEEMLELDAGQLKGDESLADLPWDSLAVVSFIALADEHLDVAVSPQRLAQA KTIGEVLALVADKLN NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgaataggcaagaatttcttaccgcgatggaagagatgctcgaattggacgccgggcaa ctgaaaggggatgaatcgttggccgatcttccctgggactcgttggccgtcgtgtccttt atcgccttggccgatgagcatcttgatgtcgcggtcagtccgcagcgcctggctcaagcc aagactattggtgaggtgctggcgctggtggcagataagctcaattga

DBGET integrated database retrieval system