Trichothermofontia sichuanensis: OOK60_05015 Help Entry OOK60_05015       CDS       T09010                                  Name (GenBank) RNA-binding protein hfq   KO K03666   host factor-I protein Organism tsz  Trichothermofontia sichuanensis Pathway tsz02024   Quorum sensing tsz03018   RNA degradation Brite KEGG Orthology (KO) [BR:tsz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     OOK60_05015  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     OOK60_05015  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tsz03019]     OOK60_05015    03036 Chromosome and associated proteins [BR:tsz03036]     OOK60_05015 Messenger RNA biogenesis [BR:tsz03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      OOK60_05015 Chromosome and associated proteins [BR:tsz03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     OOK60_05015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq_1 Hfq Motif Other DBs NCBI-ProteinID:  UZQ55438 LinkDB All DBs Position complement(1155784..1155996) Genome browser AA seq 70 aa AA seqDB search MTEFDTNLPSIRQLQTFVKEKKEVEIKLVTDDLLVGHVFWQDSQCVCLKDQYGQEVIIWR QALVYLKPKP NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgactgaattcgacacaaacttgccgagcatccgccaactccagacctttgtcaaagaa aaaaaagaggtggagattaaactggtcactgatgacctcctagtgggtcatgttttttgg caggattcccaatgtgtttgcctgaaggatcaatacggccaggaggtgatcatctggcgg caggccctggtttacctcaaacccaaaccctga

DBGET integrated database retrieval system