Pseudothermotoga thermarum: Theth_1276 Help Entry Theth_1276        CDS       T01554                                  Name (GenBank) Fe-S cluster domain protein   KO K03616   H+/Na+-translocating ferredoxin:NAD+ oxidoreductase subunit B [EC:7.1.1.11 7.2.1.2] Organism tta  Pseudothermotoga thermarum Brite KEGG Orthology (KO) [BR:tta00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     Theth_1276 Enzymes [BR:tta01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.11  ferredoxin---NAD+ oxidoreductase (H+-transporting)      Theth_1276   7.2  Catalysing the translocation of inorganic cations    7.2.1  Linked to oxidoreductase reactions     7.2.1.2  ferredoxin---NAD+ oxidoreductase (Na+-transporting)      Theth_1276 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FeS Motif Other DBs NCBI-ProteinID:  AEH51347 UniProt:  F7YUE7 LinkDB All DBs Position complement(1269646..1269936) Genome browser AA seq 96 aa AA seqDB search MLTIVYSTILLAILGFAFGTFLAYSAKKFEVKEDPRVELVRQVLPGANCGACGYPGCDGF AKAVVAGKATPDMCLPGKAAGVPEKIKEILKQNAAN NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgctgacaattgtttattcaactatattgcttgcgattcttggctttgcttttggaact tttcttgcatactctgcaaaaaaatttgaagttaaagaagatccacgtgtggaacttgta aggcaagttcttccaggtgcaaactgtggtgcgtgcggttatcctggttgcgatggtttt gcaaaagcggttgtcgctgggaaagcaactccagatatgtgtttacctggaaaagctgca ggtgttcctgagaagataaaggagatattgaaacaaaatgcagccaattga

DBGET integrated database retrieval system