Thalassospira tepidiphila: MACH01_11750 Help Entry MACH01_11750      CDS       T09750                                  Symbol groS Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism ttb  Thalassospira tepidiphila Brite KEGG Orthology (KO) [BR:ttb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ttb03110]     MACH01_11750 (groS)    03029 Mitochondrial biogenesis [BR:ttb03029]     MACH01_11750 (groS) Chaperones and folding catalysts [BR:ttb03110]  Heat shock proteins   HSP10    MACH01_11750 (groS) Mitochondrial biogenesis [BR:ttb03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     MACH01_11750 (groS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  BDW88408 LinkDB All DBs Position 1318892..1319179 Genome browser AA seq 95 aa AA seqDB search MKFRPLHDRVLVRRVESDTKTAGGIIIPDTAKEKPQEGEVIAVGSGVRKEDGSVVALDVK AGDKVLFGKWSGTEVKVDGEELLIMKESDIMGIMD NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaagttccgtccgctgcatgatcgagtactggtacgtcgtgtcgaatccgacaccaaa actgccggtggcatcattattccggataccgccaaagaaaaaccgcaggaaggcgaagtc atcgctgttggttctggcgttcgcaaagaagatggctcggtcgtagccctcgacgtcaaa gcaggtgacaaagtcctgtttggcaaatggtcgggcaccgaggtcaaggtcgacggcgaa gagctgttgatcatgaaagaatccgacatcatgggcatcatggactaa

DBGET integrated database retrieval system