Thalassospira tepidiphila: MACH01_18130 Help Entry MACH01_18130      CDS       T09750                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism ttb  Thalassospira tepidiphila Pathway ttb03060   Protein export ttb03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:ttb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     MACH01_18130  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     MACH01_18130  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:ttb02044]     MACH01_18130 Secretion system [BR:ttb02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    MACH01_18130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E DUF4834 Motif Other DBs NCBI-ProteinID:  BDW89046 LinkDB All DBs Position complement(2025725..2025961) Genome browser AA seq 78 aa AA seqDB search MGIGVWQIVLILAIVLIIFGAGKLPKVMGDMGKGIKSFKAGINEKEEDAGASAKTIENTT SASVSSESKDNEKDSVKS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgggtattggcgtttggcaaatcgttttgattcttgcgattgtcctgatcatcttcggc gcgggtaagcttccgaaagtgatgggtgacatgggcaaaggcatcaagagcttcaaagcg ggcatcaacgaaaaagaagaagatgcaggcgcttcggccaagaccatcgaaaacacgacc tctgcttcggtttcatccgagagcaaggacaatgaaaaggattctgtgaaatcctga

DBGET integrated database retrieval system