Thiohalobacter thiocyanaticus: FOKN1_0474 Help Entry FOKN1_0474        CDS       T05229                                  Name (GenBank) uncharacterized protein   KO K02277   cytochrome c oxidase subunit IV [EC:7.1.1.9] Organism ttc  Thiohalobacter thiocyanaticus Pathway ttc00190   Oxidative phosphorylation ttc01100   Metabolic pathways Module ttc_M00155   Cytochrome c oxidase, prokaryotes Brite KEGG Orthology (KO) [BR:ttc00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     FOKN1_0474 Enzymes [BR:ttc01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.9  cytochrome-c oxidase      FOKN1_0474 SSDB OrthologParalogGFIT Motif Pfam:  COX4_pro Motif Other DBs NCBI-ProteinID:  BAZ92878 UniProt:  A0A1Z4VNF2 LinkDB All DBs Position 486214..486477 Genome browser AA seq 87 aa AA seqDB search MSAIRPETLVWLLLVALTLLTWGVGQEGLNGPAVSLGLLAVALVKGHLVGDFFMGLRRVR GLWRWVIALWLLLPGGLIALAFVLAAR NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagcgcaatccgccccgagaccctggtgtggctgctgctggtggccctgaccctgctg acctggggtgtcggccaggaagggttgaacggcccggctgtctcgctggggctcctggcc gtggccctggtcaagggtcacctggtcggcgatttcttcatggggctgagacgggtgcgc ggtctctggcgctgggtgatcgccctgtggctgctgctcccgggcgggctgatcgcgctg gccttcgtgttggccgcacgctga

DBGET integrated database retrieval system