Thiohalobacter thiocyanaticus: FOKN1_1195 Help Entry FOKN1_1195        CDS       T05229                                  Name (GenBank) exonuclease VII small subunit   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism ttc  Thiohalobacter thiocyanaticus Pathway ttc03430   Mismatch repair Brite KEGG Orthology (KO) [BR:ttc00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     FOKN1_1195  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ttc03400]     FOKN1_1195 Enzymes [BR:ttc01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      FOKN1_1195 DNA repair and recombination proteins [BR:ttc03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      FOKN1_1195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S ABC_tran_CTD KxDL Vps53_N DUF6212 Motif Other DBs NCBI-ProteinID:  BAZ93594 UniProt:  A0A1Z4VQV8 LinkDB All DBs Position complement(1246148..1246381) Genome browser AA seq 77 aa AA seqDB search MARKKAQPDFEKTLAELEGLVEKMEQGDLSLEASLASFERGIELIRTCQQALSEAEQKVE QLLDKDGEPVPLEREDD NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggcacgcaaaaaggcacaacccgatttcgagaagaccctggccgagttggaaggcctg gtcgagaagatggaacagggcgacctgtccctggaggcctcgctggcctcgttcgagcgc ggcatcgagctgatccgcacctgccaacaggcgctttccgaggccgaacagaaggtcgaa cagctcctggacaaggacggcgagcccgtcccgctggaacgtgaagacgactga

DBGET integrated database retrieval system