Thiohalobacter thiocyanaticus: FOKN1_1268 Help Entry FOKN1_1268        CDS       T05229                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ttc  Thiohalobacter thiocyanaticus Pathway ttc01100   Metabolic pathways ttc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ttc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FOKN1_1268    00074 Mycolic acid biosynthesis     FOKN1_1268   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FOKN1_1268 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Methyltransf_12 CsoSCA_N Motif Other DBs NCBI-ProteinID:  BAZ93666 UniProt:  A0A1Z4VPU6 LinkDB All DBs Position 1341836..1342102 Genome browser AA seq 88 aa AA seqDB search MSTDTGNQYQEILQGLYGMLERFPTRNIDLQEQTDLVADMGLDSINVMELLQEIEDRFDI IVPLNVMSDVRTVQDLATQVQRLIRENS NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgtccactgacaccgggaatcagtaccaggaaatcctgcaggggctgtacggaatgctg gagcggtttcccacccgcaatatcgacctgcaggagcagaccgatctggtggcggacatg ggactggattccatcaatgtgatggagttgttacaggaaatcgaggaccgattcgatata atcgtgcccttgaacgtgatgtcggacgtccgcacggtgcaggatctcgccacccaggtc cagcgtctgatcagggagaactcatga

DBGET integrated database retrieval system