Thermococcus thioreducens: A3L14_02725 Help Entry A3L14_02725       CDS       T05104                                  Name (GenBank) 50S ribosomal protein L40   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism ttd  Thermococcus thioreducens Pathway ttd03010   Ribosome Brite KEGG Orthology (KO) [BR:ttd00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     A3L14_02725   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     A3L14_02725  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ttd03011]     A3L14_02725    04121 Ubiquitin system [BR:ttd04121]     A3L14_02725 Ribosome [BR:ttd03011]  Ribosomal proteins   Eukaryotes    Large subunit     A3L14_02725   Archaea     A3L14_02725 Ubiquitin system [BR:ttd04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    A3L14_02725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_Ribbon_1 DZR Zn_ribbon_RPAB4 Ribosomal_L40e Toxin_5 DZR_2 UPF0547 Zn_ribbon_3 Zn_ribbon_10 HypA Motif Other DBs NCBI-ProteinID:  ASJ11868 UniProt:  A0A0Q2M115 LinkDB All DBs Position 494821..494979 Genome browser AA seq 52 aa AA seqDB search MARFPEAEARIFRKYICMRCGATNPWKARKCRKCGYKGLRPKAREPRGGMGR NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atggcgagattcccagaggctgaggccagaatctttaggaagtacatctgcatgcgctgc ggcgctaccaacccgtggaaggccaggaagtgcagaaagtgtggctacaagggtctccgc ccgaaggcgagagagccgcgcggtggaatgggacgctga

DBGET integrated database retrieval system