KEGG   Thermus thermophilus HB27: TT_C0758
Entry
TT_C0758          CDS       T00170                                 
Name
(GenBank) biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
tth  Thermus thermophilus HB27
Pathway
tth00061  Fatty acid biosynthesis
tth00620  Pyruvate metabolism
tth00640  Propanoate metabolism
tth00720  Other carbon fixation pathways
tth01100  Metabolic pathways
tth01110  Biosynthesis of secondary metabolites
tth01120  Microbial metabolism in diverse environments
tth01200  Carbon metabolism
tth01212  Fatty acid metabolism
Module
tth_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:tth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TT_C0758
   00640 Propanoate metabolism
    TT_C0758
  09102 Energy metabolism
   00720 Other carbon fixation pathways
    TT_C0758
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    TT_C0758
Enzymes [BR:tth01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     TT_C0758
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     TT_C0758
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C ATP-grasp_3 GARS_A ATP-grasp_4 RimK ATP-grasp_5 ATPgrasp_YheCD ATPgrasp_ST DUF3182 ATP-grasp_2 LAL_C2 Rng_hyd_C VMAP-C
Other DBs
NCBI-ProteinID: AAS81104
UniProt: Q72JL4
LinkDB
Position
complement(740510..741847)
AA seq 445 aa
MKKVLIANRGEIALRIIRAARELGIKTVVAHSTADEKSLPVLLADEAICIGPPPSGQSYL
NIPNILSAAIVTGADAIHPGYGFLAENATFAEMCREHGITFIGPTPENMKALGDKATARK
VAREAGVPTVPGTDELSSVEEAKRAAQEIGYPVILKASAGGGGRGMRVVHTEEELERAVL
QAQEEARAAFGNPAVYLEKYIEEPKHIEIQVLGDGERVVHLWERDCSIQRRHQKLLEEAP
SLLPEETRRAIAEAARRLAERVGYVSAGTMEFLVDKEGNFYFIEMNTRIQVEHPVTEMIT
GIDLVQAQFRIAQGEKLWLKQEEIQVRGHAIEVRVNAEDPEKGFRPSIGKVETLLFPGGP
GVRVDSHLYTGYQIPPHYDSLIAKIIVWAPTREEAIRRMERALSETVIEGPGLKTTIPFH
QKVLQNAFFRRGAVYTNFVARRMEM
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgaagaaggtcctgatcgccaaccggggtgagatcgccttaaggatcatccgggcggcc
cgggagctcgggatcaagacggtggtggcccactccaccgccgacgagaagagccttccc
gtcctcctcgccgacgaggccatctgcatcgggccgcccccctcggggcagagctacctc
aacatccccaacatcctctccgcggccatcgtcaccggggccgacgccatccatccgggc
tacggcttcctggcggagaacgccaccttcgccgagatgtgccgggagcacgggatcacc
ttcatcggccccaccccggagaacatgaaggccctgggggacaaggccacggcgaggaag
gtggcccgggaggcgggggtgcccacggtgccgggcacggacgagctgagcagcgtggag
gaggccaagcgggcggcccaggagatcggctaccccgtgatcctcaaggcgagcgcggga
ggcgggggccggggcatgcgcgtggtccacacggaggaggagctggagcgggcggtgctc
caggcccaggaggaggcccgggccgccttcgggaaccccgccgtctacctggagaagtac
attgaggagcccaagcacattgagatccaggtcctgggggacggggaacgggtggtccac
ctttgggagcgggactgctccatccagcgccgccaccagaagcttctggaggaggccccg
agcctcctccccgaggagacccgccgggccatcgccgaggcggcgcggcgcctcgccgag
cgcgtgggctacgtgtcggcaggcacgatggagttcctggtggacaaggaggggaacttc
tacttcattgagatgaacacccgcatccaggtggagcaccccgttaccgagatgatcacg
gggattgacctggtccaggcccagttccgcatcgcccagggggagaagctctggctcaag
caggaggagatccaggtccgggggcatgccatagaggtccgggtgaacgccgaggacccg
gagaagggcttcaggccctccatcggcaaggtggaaaccctcctcttccccggggggccc
ggggtgcgggtggacagccacctctacacgggctaccagatccctccccactacgacagc
ctcatcgccaagatcatcgtctgggcccccacccgggaggaggccataaggcgcatggag
cgggccctctccgagacggtgattgaggggccgggcctcaagaccaccatccccttccac
cagaaggtcctccagaacgccttcttccgcaggggggccgtgtacaccaacttcgtggcc
cggcggatggagatgtag

DBGET integrated database retrieval system