KEGG   Thermus thermophilus HB27: TT_C0764
Entry
TT_C0764          CDS       T00170                                 

Name
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
tth  Thermus thermophilus HB27
Pathway
tth00330  Arginine and proline metabolism
tth01100  Metabolic pathways
Module
tth_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:tth00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    TT_C0764
Enzymes [BR:tth01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     TT_C0764
SSDB
Motif
Pfam: Arginase Polysacc_deac_2
Other DBs
NCBI-ProteinID: AAS81110
UniProt: Q72JK8
LinkDB
Position
complement(744984..745865)
AA seq 293 aa
MRLVFGEKDAPYEEARVVVLPVPYDLSLSFLPGARRGPEAILLASRELEPFLLELGAAPE
EVGIHAAEPVPWVAGMAEESHRLIREEALKHLRAGKWLVALGGDHSVTHPLVQAHREALG
EFSLLHVDAHADLYPEWQGSVYSHASPFYRLLTEGFPLVQVGIRAMDRDSLRLARKRGVA
LFPAHRIHREGLPLDEILEALGKRVYISLDFDALDPSLMPSVGTPLPGGLSYRQVVDLLE
AVFREKEVVGMDFVELSPNGQFHAEMTAAQLVYHAIGLKGLQAGWLSREVDHI
NT seq 882 nt   +upstreamnt  +downstreamnt
atgcgcctcgtcttcggcgaaaaggacgccccctacgaggaggcgcgggtcgtcgtcctg
cccgtgccctacgacctctccctctcctttctcccgggggcccggaggggccccgaggcc
atcctcctggcgagccgggagcttgagccctttcttttggagctaggcgccgcccccgag
gaggtggggatccacgcggccgagcccgtgccctgggtggcggggatggccgaggaaagc
caccgcctgatccgggaggaggccttaaagcacctccgggcggggaagtggctggtggcc
ctgggcggggaccactccgtcacccaccccctggtccaggcccaccgggaggccctgggg
gagttctccctcctccacgtggacgcccacgccgacctctacccggagtggcagggctcg
gtctactcccacgcaagccccttctaccgcctcctcacggaggggtttcccctggtccag
gtagggatccgggccatggaccgggactccctgcgcttggcccgaaagaggggcgtggcc
ctctttcccgcccaccggatccaccgggaagggcttcccctggacgagatccttgaggcc
ctggggaagcgggtctacatcagcctggactttgacgccctggacccctccctcatgccc
agcgtgggcacgccccttcccggggggctttcctaccgccaggtggtggacctcctcgag
gccgtcttccgcgagaaggaggtggtggggatggacttcgtggagctctccccgaacggc
cagttccacgccgagatgaccgcggcccagctcgtctaccacgccatcggcctgaaaggg
cttcaggcgggctggctttcccgggaggtggaccacatttag

DBGET integrated database retrieval system