Thermus thermophilus HB27: TT_C1152 Help Entry TT_C1152          CDS       T00170                                  Name (GenBank) hypothetical cytosolic protein   KO K23264   phosphoribosylformylglycinamidine synthase subunit PurS [EC:6.3.5.3] Organism tth  Thermus thermophilus HB27 Pathway tth00230   Purine metabolism tth01100   Metabolic pathways tth01110   Biosynthesis of secondary metabolites Module tth_M00048   De novo purine biosynthesis, PRPP + glutamine => IMP Brite KEGG Orthology (KO) [BR:tth00001]  09100 Metabolism   09104 Nucleotide metabolism    00230 Purine metabolism     TT_C1152 Enzymes [BR:tth01000]  6. Ligases   6.3  Forming carbon-nitrogen bonds    6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor     6.3.5.3  phosphoribosylformylglycinamidine synthase      TT_C1152 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PurS Motif Other DBs NCBI-ProteinID:  AAS81494 UniProt:  Q72II0 Structure PDBPDBj LinkDB All DBs Position 1118287..1118541 Genome browser AA seq 84 aa AA seqDB search MPRYQATLLIELKKGILDPQGRAVEGVLKDLGHPVEEVRVGKVLEIVFPAENLLEAEEKA KAMGALLANPVMEVYALEALKELP NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgccgcgctaccaggccaccctgctcattgagctgaagaagggcatcctggacccccag ggccgggcggtggagggggtgctgaaggacctcggccacccggtggaggaggtgcgggtg gggaaggtgctggagatcgtcttcccggcggaaaacctcctggaggccgaggagaaggcc aaggccatgggcgccctcctcgccaacccggtgatggaggtctacgccctggaagcccta aaggaactcccatga

DBGET integrated database retrieval system