Thioalkalivibrio paradoxus: THITH_00450 Help Entry THITH_00450       CDS       T03590                                  Name (GenBank) preprotein translocase   KO K03116   sec-independent protein translocase protein TatA Organism tti  Thioalkalivibrio paradoxus Pathway tti03060   Protein export tti03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:tti00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     THITH_00450  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     THITH_00450  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tti02044]     THITH_00450 Secretion system [BR:tti02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    THITH_00450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E CRA_rpt DUF7807 Motif Other DBs NCBI-ProteinID:  AHE96993 UniProt:  W0DJ12 LinkDB All DBs Position complement(86104..86409) Genome browser AA seq 101 aa AA seqDB search MGIGGISIWQLLIILLIVVLLFGTKKLRNMGGDIGSAIKNFRKSVKESGDDDSDTDKDKD AAERREGAEVPKVEEQQKGRVIDAEATKASESGSRNGDRPS NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggggatcggcggtatcagcatctggcagcttctcatcatcctgctcatcgtggtgctt ctgttcggcaccaagaagctgcgcaacatgggcggtgacatcggctccgccatcaagaac ttccgcaagtcggtcaaggaaagcggcgacgacgattcggacaccgacaaggacaaggac gccgccgagcgccgcgagggtgcagaggtacccaaggtggaagaacagcagaagggacgc gtgatcgacgccgaggccaccaaggcgtcggagtccggcagccgcaacggcgaccgcccg tcctga

DBGET integrated database retrieval system