Thioalkalivibrio paradoxus: THITH_08740 Help Entry THITH_08740       CDS       T03590                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tti  Thioalkalivibrio paradoxus Pathway tti01100   Metabolic pathways tti01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tti00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     THITH_08740 (acpP)    00074 Mycolic acid biosynthesis     THITH_08740 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     THITH_08740 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 HLH DUF1896 Motif Other DBs NCBI-ProteinID:  AHE98330 UniProt:  W0DN68 LinkDB All DBs Position complement(1844493..1844732) Genome browser AA seq 79 aa AA seqDB search MSSIEERVKKIVVEQLGAKEEDVTDSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQQAIDYIKAHMKD NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcagcattgaagaacgtgtcaagaagatcgtggttgagcaattgggcgcgaaggaa gaggacgtgaccgattccgcctcgttcgtcgaggacctgggtgccgattcgctcgacacc gtggaactggtgatggcgctcgaggaggaattcgagacggaaatcccggacgaacaggcc gagaagatcacgaccgtgcagcaggcgatcgactacatcaaggcgcacatgaaagactga

DBGET integrated database retrieval system