Thioalkalivibrio paradoxus: THITH_17085 Help Entry THITH_17085       CDS       T03590                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism tti  Thioalkalivibrio paradoxus Brite KEGG Orthology (KO) [BR:tti00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tti03110]     THITH_17085 Chaperones and folding catalysts [BR:tti03110]  Protein folding catalysts   Protein disulfide isomerase    THITH_17085 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR DSBA Motif Other DBs NCBI-ProteinID:  AHE99723 UniProt:  W0DRY1 LinkDB All DBs Position 3664954..3665211 Genome browser AA seq 85 aa AA seqDB search MYLSEFCPYCTLARQLLDQLGHAYQVIRVDIDPEQRRTMERRSGRGTVPQIFLGDTHVGG YDDLAALHRAGRLEQLIASAGRQSA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atctatctctccgaattctgcccctactgcacgctggcacgccagctgctggaccagctc gggcacgcgtaccaggtgatccgcgtcgacatcgaccccgagcagcgccgcacgatggaa cgccgctccgggcgcggcacggtgccgcagatcttccttggtgacacccatgtcggcggc tacgacgacctggccgcgctgcaccgcgccgggcgactcgagcagctgatcgccagcgca ggcaggcagagcgcatga

DBGET integrated database retrieval system