Thermus thermophilus HB8: TTHB242 Help Entry TTHB242           CDS       T00220                                  Symbol TTHB242 Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism ttj  Thermus thermophilus HB8 Pathway ttj00362   Benzoate degradation ttj00621   Dioxin degradation ttj00622   Xylene degradation ttj01100   Metabolic pathways ttj01120   Microbial metabolism in diverse environments ttj01220   Degradation of aromatic compounds Module ttj_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:ttj00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     TTHB242 (TTHB242)    00622 Xylene degradation     TTHB242 (TTHB242)    00621 Dioxin degradation     TTHB242 (TTHB242) Enzymes [BR:ttj01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      TTHB242 (TTHB242) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  BAD72038 UniProt:  Q53WI4 Structure PDBPDBj LinkDB All DBs Position pTT27:complement(248470..248664) Genome browser AA seq 64 aa AA seqDB search MVVLKVTLLEGRPPEKKRELVRRLTEMASRLLGEPYEEVRVILYEVRRDQWAAGGVLFSD KEGT NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atggtggtgctcaaggtgaccctactggagggccgcccccccgagaagaagcgggagctg gtgcggaggctcacggagatggcttcccgcctcctcggcgagccctacgaggaggtccgg gtcatcctctacgaggtgcgccgggaccagtgggcggcggggggcgtgctcttctcggac aaggaggggacatga

DBGET integrated database retrieval system