Thermus thermophilus JL-18: TtJL18_1666 Help Entry TtJL18_1666       CDS       T02009                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ttl  Thermus thermophilus JL-18 Pathway ttl01100   Metabolic pathways ttl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ttl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TtJL18_1666    00074 Mycolic acid biosynthesis     TtJL18_1666   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TtJL18_1666 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AFH39539 UniProt:  H9ZT79 LinkDB All DBs Position 1546383..1546625 Genome browser AA seq 80 aa AA seqDB search MTEQEIFEKVKAVIADKLQVEPEKVTLEARFIEDLGADSLDTVELIMGLEDEFGLEISDE EAEKIRTVKDAVEYIKAKLG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacggagcaggagatctttgagaaggtgaaggcggtgatcgcggacaagctccaggtg gagccggagaaggtgaccctcgaggcccgcttcattgaggacctgggggcggacagcctg gacaccgtggagctcatcatgggcctggaggacgagttcggcctggagatctccgacgag gaggccgagaagatccgcaccgtcaaggacgccgtggagtacatcaaggccaagctgggc taa

DBGET integrated database retrieval system