Thermoproteus tenax: TTX_0912 Help Entry TTX_0912          CDS       T01641                                  Symbol rps27ae Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism ttn  Thermoproteus tenax Pathway ttn03010   Ribosome Brite KEGG Orthology (KO) [BR:ttn00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     TTX_0912 (rps27ae)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     TTX_0912 (rps27ae)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ttn03011]     TTX_0912 (rps27ae)    04121 Ubiquitin system [BR:ttn04121]     TTX_0912 (rps27ae)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ttn04147]     TTX_0912 (rps27ae) Ribosome [BR:ttn03011]  Ribosomal proteins   Eukaryotes    Small subunit     TTX_0912 (rps27ae)   Archaea     TTX_0912 (rps27ae) Ubiquitin system [BR:ttn04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    TTX_0912 (rps27ae) Exosome [BR:ttn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    TTX_0912 (rps27ae)   Exosomal proteins of colorectal cancer cells    TTX_0912 (rps27ae) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Cas12f1-like_TNB Zn_ribbon_Nudix Zn_ribbon_NUD GFA Zn_ribbon_RPB9 Zn_Ribbon_1 Zn_ribbon_3 EDR4-like_1st Zn_ribbon_PriA STEEP1 ADK_lid Zn_Ribbon_TF Lar_restr_allev Rpr2 Zn_ribbon_NOB1 DZR Zn_ribbon_ISL3 Motif Other DBs NCBI-ProteinID:  CCC81565 UniProt:  G4RPS0 LinkDB All DBs Position complement(791280..791462) Genome browser AA seq 60 aa AA seqDB search MSEGKKLPRAATWYLLDIEKGIFKFTRRFCPRCGSVMAYHKEPVPRWHCGKCGMTIFEKK NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgagcgagggcaagaagttgccaagagctgccacgtggtatctactggatatagagaag gggatattcaagttcacaaggcgcttttgtccgcggtgcggctctgtgatggcgtaccac aaggagccagtgccgaggtggcactgtggaaagtgtggaatgacgatcttcgagaaaaag tag

DBGET integrated database retrieval system