Thermochromatium tepidum: E6P07_08530 Help Entry E6P07_08530       CDS       T06573                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism ttp  Thermochromatium tepidum Brite KEGG Orthology (KO) [BR:ttp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ttp03110]     E6P07_08530 (grxC) Chaperones and folding catalysts [BR:ttp03110]  Protein folding catalysts   Protein disulfide isomerase    E6P07_08530 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like Thioredoxin_2 Thioredoxin_3 SH3BGR CLIC-like_N GST_N Redoxin Motif Other DBs NCBI-ProteinID:  QGU33019 UniProt:  A0A6I6EDI0 LinkDB All DBs Position 1884849..1885115 Genome browser AA seq 88 aa AA seqDB search MPQVTVYTTQTCPYCDRARRLLKRKGVHFTEIPVDQDRARMTEMVERSGRHTVPQIFIDD FHVGGYDDMVLLDMEGELDERLGLDTDD NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgccccaggtcactgtctacacgacccaaacctgcccctactgcgaccgcgcgcggcgc ctactcaagcgcaagggcgtccactttaccgagatcccagtcgatcaagatcgcgcgcgc atgaccgagatggtcgagcgcagcggtcgccatacggtcccacagatcttcatcgatgac ttccacgtcggcggctatgacgacatggtgctgctcgacatggagggcgaactcgatgaa cgcctcggactcgacaccgatgactga

DBGET integrated database retrieval system