Thermochromatium tepidum: E6P07_09035 Help Entry E6P07_09035       CDS       T06573                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ttp  Thermochromatium tepidum Pathway ttp01100   Metabolic pathways ttp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ttp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E6P07_09035 (acpP)    00074 Mycolic acid biosynthesis     E6P07_09035 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E6P07_09035 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  QGU33107 UniProt:  A0A6I6EJ04 LinkDB All DBs Position complement(1973401..1973637) Genome browser AA seq 78 aa AA seqDB search MSSVEERVRKIVVDQLGVKEEEVTPEASFVDDLGADSLDTVELVMALEEEFETEIPDEDA EKITTVQQAIDYIKAHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcagcgttgaagaacgagttcgcaaaatcgtggtggaccagctgggcgtgaaggaa gaggaagtcaccccagaggcgtccttcgtcgacgatctgggagcggactcgctcgacacc gtggaactggtcatggccctcgaagaggagttcgagaccgagatcccggacgaagacgcc gagaagatcaccacggtccagcaggccatcgactacatcaaagcgcaccaggcctga

DBGET integrated database retrieval system