Thermochromatium tepidum: E6P07_12385 Help Entry E6P07_12385       CDS       T06573                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism ttp  Thermochromatium tepidum Brite KEGG Orthology (KO) [BR:ttp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ttp03036]     E6P07_12385 (ftsB) Chromosome and associated proteins [BR:ttp03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     E6P07_12385 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC Docking ZapB Myosin_tail_1 CAGE1 DUF7310 Herpes_UL25 DUF4349 HALZ Bap31_Bap29_C NUDE_C Spc24 CCDC90-like APG6_N Motif Other DBs NCBI-ProteinID:  QGU33705 UniProt:  A0A6I6E427 LinkDB All DBs Position complement(2672754..2673056) Genome browser AA seq 100 aa AA seqDB search MYWLILVLTLLLGALQYRLWVGEGSLAELHSLKREIALEESELERLRARNRALQAEVDDL REGSEAIEERARSELGMIKPGEIFIQVIERPRSANPEGRP NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgtactggttgatcctggtattgaccctgcttctgggcgcgctccagtaccggctctgg gtcggcgaggggagcctcgccgagctccacagcctcaagcgcgagatcgccctcgaggag tccgagctggagcggctgcgcgcgcgcaatcgcgcgcttcaggccgaggttgacgacctg cgcgaaggctccgaggcgatcgaggagcgtgcgcgcagcgagctgggcatgatcaagccg ggcgagatctttatccaggtcatcgaacgacctaggtccgccaatccggagggtcgacca tga

DBGET integrated database retrieval system